PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 254aa    MW: 28987.2 Da    PI: 6.2873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018029.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +v+++G  +W+  ++  g+ R++k+c++rw +yl
      Pbr018029.1 14 KGTWTPEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding58.12e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE+e +v+++++lG++ W++Ia+ ++ gRt++++k++w++ 
      Pbr018029.1  67 RGNYSKEEEETIVKLHEKLGNR-WSAIAAQLP-GRTDNEIKNHWHTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.779961IPR017930Myb domain
SuperFamilySSF466894.3E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-111363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231568IPR009057Homeodomain-like
CDDcd001672.51E-91661No hitNo description
PROSITE profilePS5129425.82562116IPR017930Myb domain
SMARTSM007172.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001673.60E-1269112No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2569115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVRTPCRDEN GMKKGTWTPE EDRKLIAYVT RYGCWNWRQL PKFAGLSRCG KSCRLRWMNY  60
LRPNIKRGNY SKEEEETIVK LHEKLGNRWS AIAAQLPGRT DNEIKNHWHT NLKKRTNKKQ  120
CNSSFSSSAT NTEETPSSSN LEAAVDQPIK KAIFPNAEST TALQVTQKSD DRVDNSSQLS  180
SSPQPSSSEV SSMSADDNWV NFVEDFNLSS MDAYADNQFI DDFWTEPFLA DNSYIPSGFY  240
TPLMDSEFLY PLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353213.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH43e-61MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLD9ZJ561e-172D9ZJ56_MALDO; MYB domain class transcription factor
STRINGPOPTR_0013s14560.15e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.19e-61myb domain protein 14